AV53607
Anti-TNP1 antibody produced in rabbit
affinity isolated antibody
Sinônimo(s):
Anti-TP1, Anti-Transition protein 1 (duRing Histone to protamine replacement)
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
Produtos recomendados
fonte biológica
rabbit
Nível de qualidade
conjugado
unconjugated
forma do anticorpo
affinity isolated antibody
tipo de produto de anticorpo
primary antibodies
clone
polyclonal
Formulário
buffered aqueous solution
peso molecular
6 kDa
reatividade de espécies
mouse, dog, human, rat, rabbit, horse, pig
concentração
0.5 mg - 1 mg/mL
técnica(s)
western blot: suitable
nº de adesão NCBI
nº de adesão UniProt
Condições de expedição
wet ice
temperatura de armazenamento
−20°C
modificação pós-traducional do alvo
unmodified
Informações sobre genes
human ... TNP1(7141)
Categorias relacionadas
Descrição geral
TNP1 (transition protein 1) gene also referred to as TP1 encodes a 54 amino acids containing nuclear protein that belongs to nuclear transition protein 1 family. It is a spermatid-specific product of the haploid genome which replaces histone and is itself replaced in the mature sperm by the protamines. It is also a basic protein well conserved in mammalian species. It has a role in spermiogenesis. Mutation in TNP1 gene leads to male infertility.
Imunogênio
Synthetic peptide directed towards the N terminal region of human TNP1
Aplicação
Anti-TNP1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Ações bioquímicas/fisiológicas
In mammals, the second stage of spermatogenesis is characterised by the conversion of nucleosomal chromatin to compact, non-nucleosomal and transcriptionally inactive form found in sperm nucleus. This condensation is associated with a double-protein transition. The first transition corresponds to the replacement of histones by several spermatid-specific proteins (also called transition proteins) which are themselves replaced by protamines during the second transition. In the elongating spermatids of mammals, the conversion of nucleosomal chromatin to the compact, non-nucleosomal form found in the sperm nucleus is associated with the appearance of a small set of basic chromosomal transition proteins.
Sequência
Synthetic peptide located within the following region: MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRN
forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Não está encontrando o produto certo?
Experimente o nosso Ferramenta de seleção de produtos.
Código de classe de armazenamento
10 - Combustible liquids
Classe de risco de água (WGK)
WGK 3
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Escolha uma das versões mais recentes:
Certificados de análise (COA)
Lot/Batch Number
Não está vendo a versão correta?
Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
The mouse transition protein 1 gene contains a B1 repetitive element and is located on chromosome 1.
P C Yelick et al.
Genomics, 11(3), 687-694 (1991-11-01)
The gene for mouse transition protein 1 (mTP1) was isolated, sequenced, and chromosomally mapped. The nucleotide sequence of 1895 bp of a 6.4-kb mTP1 genomic subclone was determined to include 788 bp of 5' flanking region, 564 bp of coding
Marvin L Meistrich et al.
Chromosoma, 111(8), 483-488 (2003-05-14)
The transition nuclear proteins (TPs) constitute 90% of the chromatin basic proteins during the steps of spermiogenesis between histone removal and the deposition of the protamines. We first summarize the properties of the two major transition nuclear proteins, TP1 and
K C Kleene et al.
Biochimica et biophysica acta, 950(2), 215-220 (1988-07-13)
We have determined the nucleotide sequence of cDNA clones encoding mouse transition protein 1 (TP1), a basic nuclear protein involved in nuclear condensation during spermiogenesis. The nucleotide sequence predicts that transition protein 1 in rats and mice differs by only
F Chirat et al.
European journal of biochemistry, 198(1), 13-20 (1991-05-23)
The ram transition protein 1 (TP1) is present in spermatid cell nuclei in the nonphosphorylated, monophosphorylated and diphosphorylated forms. Its primary structure was determined by automated Edman degradation of S-carboxamidomethylated protein and of peptides generated by cleavage with thermolysin and
Yasushi Miyagawa et al.
Journal of andrology, 26(6), 779-786 (2005-11-18)
Previously, we examined the relationship between protamine gene variations and human male infertility. In this study, we show specific variability in the transition nuclear protein genes (TNPs) of sterile male patients. Transition nuclear proteins (TPs) are major nuclear proteins that
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica