Pular para o conteúdo
Merck
Todas as fotos(3)

Documentos

AV46350

Sigma-Aldrich

Anti-CDT1 antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-Chromatin licensing and DNA replication factor 1, Anti-DUP, Anti-RIS2

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(3)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

forma

buffered aqueous solution

peso molecular

60 kDa

reatividade de espécies

human, mouse, pig, rat

concentração

0.5 mg - 1 mg/mL

técnica(s)

immunohistochemistry: suitable
western blot: suitable

nº de adesão NCBI

NP_112190

nº de adesão UniProt

Q9H211

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... CDT1(81620)

Imunogênio

Synthetic peptide directed towards the C terminal region of human CDT1

Aplicação

Anti-CDT1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/ml.

Ações bioquímicas/fisiológicas

CDT1 (chromatin licensing and DNA replication factor 1) gene also referred to as DUP or RIS2 encodes for a protein that is a nuclear localizing replication initiation factor and is expressed only during the G1 and S phases of the cell cycle. CDT1 interacts with CDC6 and stimulates the loading of the mini-chromosome maintenance complex onto chromatin. Hence it forms a pre-replication complex necessary to initiate DNA replication. Further, geminin inhibits CDT1 and may facilitate the inhibition of replication at inappropriate origins. Overexpression of Cdt1 mRNA and geminin may play a crucial role in pathogenesis of acute leukemia (AL).

Sequência

Synthetic peptide located within the following region: PATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQ

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Ke-Hua Zhang et al.
Zhongguo shi yan xue ye xue za zhi, 19(3), 578-581 (2011-07-07)
The purpose of this study was to detect the expression levels of geminin and cdt1 in peripheral blood and bone marrow from patients with newly diagnosed acute leukemia (AL), and further explore effects of them in the pathogenesis of AL.
J A Wohlschlegel et al.
Science (New York, N.Y.), 290(5500), 2309-2312 (2000-12-23)
In all eukaryotic organisms, inappropriate firing of replication origins during the G2 phase of the cell cycle is suppressed by cyclin-dependent kinases. Multicellular eukaryotes contain a second putative inhibitor of re-replication called geminin. Geminin is believed to block binding of
Jeanette Gowen Cook et al.
The Journal of biological chemistry, 279(10), 9625-9633 (2003-12-16)
Chromosomal DNA replication requires the recruitment of the six-subunit minichromosome maintenance (Mcm) complex to chromatin through the action of Cdc6 and Cdt1. Although considerable work has described the functions of Cdc6 and Cdt1 in yeast and biochemical systems, evidence that
Zannel Blanchard et al.
PloS one, 9(4), e95663-e95663 (2014-05-03)
Breast cancer is the second leading cause of cancer-related deaths in women. Triple negative breast cancer (TNBC) is an aggressive subtype that affects 10-25% mostly African American women. TNBC has the poorest prognosis of all subtypes with rapid progression leading

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica