Pular para o conteúdo
Merck
Todas as fotos(1)

Documentos Principais

AV46228

Sigma-Aldrich

Anti-PIP3-E (AB1) antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-IPCEF1, Anti-KIAA0403, Anti-Phosphoinositide-binding protein PIP3-E, Anti-RP3-402L9.2

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

49 kDa

reatividade de espécies

human

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

NP_001124171

nº de adesão UniProt

Q8WWN9

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... PIP3-E(26034)

Imunogênio

Synthetic peptide directed towards the middle region of human PIP3-E

Aplicação

Anti-PIP3-E (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/ml.

Ações bioquímicas/fisiológicas

PIP3-E (Phosphoinositide-binding protein PIP3-E) also referred to as Interactor protein for cytohesin exchange factors 1 (IPCEF1) is a protein that binds to cytohesin 2 and augments its activity in cultured cells. This results in the nerve injury-induced membrane receptor trafficking in the dorsal root ganglions (DRGs) of adult rats under neuropathic pain conditions. Further, IPCEF1 produces a single protein that plays a crucial role in HGF-induced Arf6 activation and migration in response to HGF treatment.

Sequência

Synthetic peptide located within the following region: IHKALENSFVTSESGFLNSLSSDDTSSLSSNHDHLTVPDKPAGSKIMDKE

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number
QC22944

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Pesquise por COA

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Xiang Zhang et al.
Journal of experimental & clinical cancer research : CR, 39(1), 190-190 (2020-09-18)
Insulin-like growth factor 2 (IGF2) messenger RNA binding protein 3 (IMP3) has been testified to be overexpressed in prostate cancer and strongly related to patients' poor prognosis. However, the functions of IMP3 and the underlying mechanisms in prostate cancer still
Myriam A Attar et al.
Experimental cell research, 318(3), 228-237 (2011-11-17)
Epithelial cells are largely immotile under normal circumstances, but become motile during development, repair of tissue damage and during cancer metastasis. Numerous growth factors act to initiate epithelial cell movements. Hepatocyte growth factor (HGF) induces many epithelial cell lines to
Xiaowei Guan et al.
Naunyn-Schmiedeberg's archives of pharmacology, 380(5), 459-463 (2009-09-17)
Interaction protein for cytohesin exchange factors 1 (IPCEF1) is a recently identified protein that binds to cytohesin 2 and might participate in membrane receptor trafficking by enhancing the activity of cytohesin 2 in cultured cells. However, whether IPCEF1 is involved

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica