AV44019

Anti-SLC30A1 antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-Solute carrier family 30 (Zinc transporter), member 1, Anti-ZNT1, Anti-ZRC1
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 55 kDa
• reatividade de espécies: human
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): western blot: suitable
• nº de adesão NCBI: NP_067017
• nº de adesão UniProt: Q9Y6M5
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... SLC30A1(7779)

Descrição

Descrição geral

Solute carrier family 30, member 1 (SLC30A1, ZNT1, ZRC1) is a zinc transporter involved in regulating zinc and other divalent cation flux. SLC30A1/ ZNT1 is frequently coexpressed with L-type voltage-dependent calcium channel (LTCC), a major route for zinc influx. SLC30A1/ ZNT1 is believed to regulate cellular ion (calcium, cadmium, zinc) homeostasis, at least in part, by modulating/inhibiting L-type calcium channels.

Especificidade

Anti-SLC30A1 polyclonal antibody reacts with human, canine, and pig solute carrier family 30, member 1/ZNT1 proteins.

Imunogênio

Synthetic peptide directed towards the middle region of human SLC30A1

Aplicação

Anti-SLC30A1 polyclonal antibody is used to tag solute carrier family 30, member 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 30, member 1 in divalent cation (Zn²⁺, Cd²⁺, Ca²⁺) homeostasis, especially in conjunction with L-type voltage-dependent calcium channels.

Ações bioquímicas/fisiológicas

SLC30A1 may be involved in zinc transport out of the cell.

Sequência

Synthetic peptide located within the following region: FCVNPCFPDPCKAFVEIINSTHASVYEAGPCWVLYLDPTLCVVMVCILLY

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable