AV31477

Anti-SLC30A9 (AB1) antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-Solute carrier family 30 (Zinc transporter), member 9
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• peso molecular: 63 kDa
• reatividade de espécies: rat, human, horse, guinea pig, rabbit, bovine, dog
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunohistochemistry: suitable; western blot: suitable
• nº de adesão NCBI: NP_006336
• nº de adesão UniProt: Q6PML9
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... SLC30A9(10463)

Descrição

Descrição geral

SLC30A9 is a member of the solute carrier family that may function as a zinc transporter.
Rabbit Anti-SLC30A9 (AB1) antibody recognizes rat, human, canine, mouse, pig, bovine, and zebrafish SLC30A9.

The previously assigned protein identifier Q9Y6R2 has been merged into Q6PML9. Full details can be found on the UniProt database.

Imunogênio

Synthetic peptide directed towards the N terminal region of human SLC30A9

Aplicação

Rabbit Anti-SLC30A9 (AB1) antibody is suitable for use in western blot assays at a concentration of 0.5-2.0μg/ml. The antibody can also be used for IHC at 4-8μg/ml, using paraffin-embedded tissues.

Ações bioquímicas/fisiológicas

The gene corresponding to embryonic lung protein [also known as Solute carrier family 30 (Zinc transporter), member 9, SLC30A9], is likely to be an evolutionarily conserved, housekeeping gene that plays a role intimately linked with cellular replication, DNA synthesis and/or transcriptional regulation.

Sequência

Synthetic peptide located within the following region: LKQEPLQVRVKAVLKKREYGSKYTQNNFITGVRAINEFCLKSSDLEQLR

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable