Pular para o conteúdo
Merck
Todas as fotos(1)

Documentos Principais

AV43788

Sigma-Aldrich

Anti-SLC25A29 antibody produced in rabbit

IgG fraction of antiserum

Sinônimo(s):

Anti-C14orf69, Anti-FLJ38975, Anti-Solute carrier family 25, member 29

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41
clone:
polyclonal
application:
WB
reatividade de espécies:
human, bovine, dog, rabbit, guinea pig, horse, rat, mouse
técnica(s):
western blot: suitable
citations:
2

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

IgG fraction of antiserum

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

33 kDa

reatividade de espécies

human, bovine, dog, rabbit, guinea pig, horse, rat, mouse

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

Informações sobre genes

Imunogênio

Synthetic peptide directed towards the C terminal region of human SLC25A29

Ações bioquímicas/fisiológicas

SLC25A29 is a member of solute carrier (SLC) family 25 of transporters also called as mitochondrial carrier family. The members of this family are present in the inner mitochondrial membranes and connect cytoplasmic and mitochondrial matrices. SLC25A29 is involved in the transport of basic amino acids into the mitochondria, protein synthesis and amino acid degradation in mitochondria.

Sequência

Synthetic peptide located within the following region: AEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEEAGPEGEAVPA

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Vito Porcelli et al.
The Journal of biological chemistry, 289(19), 13374-13384 (2014-03-22)
The human genome encodes 53 members of the solute carrier family 25 (SLC25), also called the mitochondrial carrier family, many of which have been shown to transport carboxylates, amino acids, nucleotides, and cofactors across the inner mitochondrial membrane, thereby connecting
Ferdinando Palmieri
Molecular aspects of medicine, 34(2-3), 465-484 (2012-12-26)
SLC25 is a large family of nuclear-encoded transporters embedded in the inner mitochondrial membrane and in a few cases other organelle membranes. The members of this superfamily are widespread in eukaryotes and involved in numerous metabolic pathways and cell functions.

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica