Pular para o conteúdo
Merck
Todas as fotos(2)

Documentos Principais

AV45176

Sigma-Aldrich

Anti-CDH8 antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-Cadherin 8, type 2, Anti-Nbla04261

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

81 kDa

reatividade de espécies

human, mouse, dog, bovine, rat, horse, rabbit, guinea pig

concentração

0.5 mg - 1 mg/mL

técnica(s)

immunohistochemistry: suitable
western blot: suitable

nº de adesão NCBI

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... CDH8(1006)

Imunogênio

Synthetic peptide directed towards the middle region of human CDH8

Aplicação

Anti-CDH8 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Ações bioquímicas/fisiológicas

CDH8 (Cadherin 8, type II), a classical cadherin, is a membrane protein that mediates calcium-dependent cell-cell adhesion. It is expressed predominantly in brain and modulates synaptic adhesion and axon growth. Microdeletions in CDH8 gene result in increased susceptibility to autism and learning disability.

Sequência

Synthetic peptide located within the following region: HENAALNSVIGQVTARDPDITSSPIRFSIDRHTDLERQFNINADDGKITL

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

N Toni et al.
Nature, 402(6760), 421-425 (1999-12-10)
Structural remodelling of synapses and formation of new synaptic contacts has been postulated as a possible mechanism underlying the late phase of long-term potentiation (LTP), a form of plasticity which is involved in learning and memory. Here we use electron
Alistair T Pagnamenta et al.
Journal of medical genetics, 48(1), 48-54 (2010-10-26)
Autism spectrum disorder (ASD) is characterised by impairments in social communication and by a pattern of repetitive behaviours, with learning disability (LD) typically seen in up to 70% of cases. A recent study using the PPL statistical framework identified a
George W Huntley et al.
Hippocampus, 22(1), 17-28 (2010-09-18)
Cadherins are synaptic cell adhesion molecules that contribute to persistently enhanced synaptic strength characteristic of long-term potentiation (LTP). What is relatively unexplored is how synaptic activity of the kind that induces LTP-associated remodeling of synapse structure affects localization of cadherins

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica