AV41491

Anti-GPX3 antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-GPx-P, Anti-GSHPx-3, Anti-GSHPx-P, Anti-Glutathione Peroxidase 3 (plasma)
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 25 kDa
• reatividade de espécies: mouse, rat, human, bovine
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunohistochemistry: suitable; western blot: suitable
• nº de adesão NCBI: NP_002075
• nº de adesão UniProt: P22352
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... GPX3(2878)

Descrição

Descrição geral

Glutathione peroxidase refers to a family of isozymes that protect organisms from oxidative damage by reducing lipid hydroperoxides to their corresponding alcohols. Glutathione peroxidase 3 (GPX3) is an extracellular Gpx isozyme found mainly in plasma.

Especificidade

Anti-GPX3 polyclonal antibody reacts with human, mouse, rat, bovine, canine, and pig glutathione peroxidase 3 proteins.

Imunogênio

Synthetic peptide directed towards the N terminal region of human GPX3

Aplicação

Anti-GPX3 polyclonal antibody is used to tag glutathione peroxidase-3 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to study the antioxidant lipid protecting role of glutathione peroxidase 3 in extracellular space and plasma.

Ações bioquímicas/fisiológicas

GPX3 belongs to the glutathione peroxidase family, which functions in the detoxification of hydrogen peroxide. It contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination.Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme. GPX3 expression appears to be tissue-specific.

Sequência

Synthetic peptide located within the following region: DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable