AV39623

Anti-CBLL1 antibody produced in rabbit

IgG fraction of antiserum

• Sinônimo(s): Anti-Cas-Br-M (murine) ecotropic retroviral transforming sequence-like 1
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: IgG fraction of antiserum
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• peso molecular: 55 kDa
• reatividade de espécies: bovine, rat, human, mouse, horse, dog
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): western blot: suitable
• nº de adesão NCBI: NP_079090
• nº de adesão UniProt: Q75N03
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• Informações sobre genes: human ... CBLL1(79872)

Descrição

Descrição geral

CBLL1 (Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase) is a cbl-like ubiquitin ligase of E-cadherin complex. It is expressed in the neurons of central nervous system.
Rabbit Anti-CBLL1 antibody recognizes human, mouse, rat, zebrafish, canine, and chicken CBLL1.

Imunogênio

Synthetic peptide directed towards the C terminal region of human CBLL1

Aplicação

Rabbit Anti-CBLL1 antibody is suitable for western blot applications at a concentration of 1.25μg/ml.

Ações bioquímicas/fisiológicas

CBLL1 (Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase) is an E-cadherin binding protein involved in the ubiquitination of E-cadherin and regulation of E-cadherin complex endocytosis. During ubiquitination, it directly binds to the cytoplasmic domain of E-cadherin. It has been reported in a study that CBLL1 may play a role in neuronal apoptosis and in LPS (Lipopolysaccharide) administration. CBLL1 also have been predicted as a regulator of cell proliferation.

Sequência

Synthetic peptide located within the following region: PFTQPGGMSPGIWPAPRGPPPPPRLQGPPSQTPLPGPHHPDQTRYRPYYQ

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable