AV100841

Anti-IRF8 antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-Interferon regulatory factor 8
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• peso molecular: 48 kDa
• reatividade de espécies: human, dog, rat, horse, rabbit, guinea pig, mouse, bovine
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunohistochemistry: suitable; western blot: suitable
• nº de adesão NCBI: NP_002154
• nº de adesão UniProt: Q02556
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... IRF8(3394)

Descrição

Descrição geral

Interferon regulatory factors are transcription factors that regulate the expression of interferon system. The activity of IRF-8 has been implicated in vascular diseases.

Imunogênio

Synthetic peptide directed towards the N terminal region of human IRF8

Aplicação

Anti-IRF8 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5-2 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.

Ações bioquímicas/fisiológicas

IRF-8 regulates the activity of myocardin and modulates the phenotype of smooth muscle cells. It regulates the development and function of T cells, B cells and macrophages. IRF-8 induces the production of type 1 interferons in dendritic cells.

Sequência

Synthetic peptide located within the following region: MFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRC

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable