AMAB91041

Monoclonal Anti-VGLUT1 antibody produced in mouse

Prestige Antibodies^® Powered by Atlas Antibodies, clone CL2754, purified immunoglobulin, buffered aqueous glycerol solution

• Sinônimo(s): BNPI, SLC17A7
• Código UNSPSC: 12352203
• Número do Atlas de Proteínas Humanas: AMAB91041
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: CL2754, monoclonal
• linha de produto: Prestige Antibodies^® Powered by Atlas Antibodies
• forma: buffered aqueous glycerol solution
• reatividade de espécies: mouse, human, rat
• validação aprimorada: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• técnica(s): immunoblotting: 1 μg/mL; immunohistochemistry: 1:5000- 1:10000
• Isotipo: IgG2b
• sequência de imunogênio: PSISEEERKYIEDAIGESAKLMNPLTKFSTP
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... VGLUT1(57030)

Descrição

Descrição geral

Vesicular glutamate transporter 1 (VGLUT1), also called as solute carrier family 17 member 7
(SLC17A7), is encoded by the gene mapped to human chromosome 19q13, a region associated with schizophrenia. VGLUT1 is specifically expressed in neuronal cells in the brain and at higher level in neuron-enriched regions such as the amygdala and hippocampus. Glia-enriched areas such as the corpus callosum also show moderate level of expression and substantia nigra, subthalamic nuclei and thalamus show low level expression. VGLUT1 is characterized with a conserved C-terminal dileucine-like motif and two polyproline domains distal to C- terminal end, including one that binds to endocytic BAR (Bin/Amphiphysin/Rvs) domain protein, endophilin.

Imunogênio

solute carrier family 17 member 7

Aplicação

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Ações bioquímicas/fisiológicas

Vesicular glutamate transporter 1 (VGLUT1) plays a vital role as an vesicular glutamate transporter in glutamatergic neurons. VGLUT1 expression in the prefrontal cortex, functions as a potential neurochemical marker of dementia in Alzheimer disease (AD) and antidepressant activity.

Características e benefícios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST70070

forma física

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1