AMAB90859

Monoclonal Anti-MCL1 antibody produced in mouse

Prestige Antibodies^® Powered by Atlas Antibodies, clone CL1128, purified immunoglobulin, buffered aqueous glycerol solution

• Sinônimo(s): BCL2L3, Mcl-1
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: CL1128, monoclonal
• linha de produto: Prestige Antibodies^® Powered by Atlas Antibodies
• forma: buffered aqueous glycerol solution
• reatividade de espécies: human
• técnica(s): immunoblotting: 1 μg/mL; immunofluorescence: 2-10 μg/mL (Fixation/Permeabilization: PFA/Triton X-100); immunohistochemistry: 1:500- 1:1000
• Isotipo: IgG1
• Ensembl | Número de adesão de ser humano: ENSG00000143384
• nº de adesão UniProt: Q07820
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... MCL1(4170)

Descrição

Descrição geral

Induced myeloid leukemia cell differentiation protein (Mcl-1) belongs to B-cell lymphoma 2 (Bcl-2) apoptotic protein family. The Mcl-1 gene is mapped to human chromosome 1q21. It encodes a protein of 42 kDa. The alternate spliced variant is a small protein of 30 kDa. It contains three Bcl-2 homology (BH) domains whereas the alternate spliced has only one BH domain.

Imunogênio

myeloid cell leukemia sequence 1 (BCL2-related), recombinant protein epitope signature tag (PrEST)

Sequence
DAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDG

Epitope
Binds to an epitope located within the peptide sequence PEEELDGYEP as determined by overlapping synthetic peptides.

Aplicação

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Ações bioquímicas/fisiológicas

Induced myeloid leukemia cell differentiation protein (Mcl-1) functions as anti-apoptotic protein. Mcl-1 is upregulated in several carcinomas and is a key factor contributing to drug resistance in chemotherapies. It favors tumorigenesis in multiple myeloma and plays a crucial role in tumor progression. Spliceosome based inhibitors for Mcl-1 are suggested for prevent cancer metastasis.

Características e benefícios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST70113

forma física

Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable