Pular para o conteúdo
Merck
Todas as fotos(9)

Documentos Principais

AMAB90730

Sigma-Aldrich

Monoclonal Anti-WWTR1 antibody produced in mouse

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, clone CL0371, purified immunoglobulin, buffered aqueous glycerol solution

Sinônimo(s):

DKFZp586I1419, TAZ

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

mouse

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

CL0371, monoclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

Formulário

buffered aqueous glycerol solution

reatividade de espécies

human

validação aprimorada

orthogonal RNAseq
RNAi knockdown
Learn more about Antibody Enhanced Validation

técnica(s)

immunoblotting: 1 μg/mL
immunofluorescence: 2-10 μg/mL
immunohistochemistry: 1:50- 1:200

Isotipo

IgG1

Ensembl | Número de adesão de ser humano

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... WWTR1(25937)

Categorias relacionadas

Descrição geral

WWTR1 (WW domain containing transcription regulator 1) is also known as TAZ (transcriptional co-activator with PDZ-binding motif). It is a transcriptional coactivator with a N-terminal TEAD-binding motif and without a DNA-binding motif. TAZ is a 14-3-3 binding protein that is expressed at high level in thyroid, kidney, heart, placenta and lung. It is present in cytoplasm and nucleus. The WWTR1 gene is located on human chromosome 3q25.1.

Imunogênio

Recombinant protein corresponding to WW domain containing transcription regulator 1.

Sequence
MNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSST

Epitope
Binds to an epitope located within the peptide sequence SSWRKKILPESFFKE as determined by overlapping synthetic peptides.

Aplicação

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Ações bioquímicas/fisiológicas

WWTR1(WW domain containing transcription regulator 1)/TAZ (transcriptional co-activator with PDZ-binding motif) stimulates the multiplication of glioma cell and represses the apoptosis of glioma cells. TEADs are important interacting transcription factors of TAZ, which serve as effectors to promote cell proliferation, migration and epithelial-mesenchymal transition. TAZ participates in mesenchymal stem cell differentiation. It plays a vital role in mechanotransduction. Overexpression of TAZ leads to increased cell proliferation, epithelial-mesenchymal transition (EMT), cell migration and transformation.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST70841

forma física

Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

WWTR1 (WW domain containing transcription regulator 1).
Zhao Y and Yang X
Atlas of Genetics and Cytogenetics in Oncology and Haematology, 18(11), 849-849 (2014)
The role of transcriptional coactivator TAZ in gliomas.
Li W, et al.
Oncotarget, 7(50), 82686?82699-82686?82699 (2016)
Patricia García et al.
Cancers, 12(4) (2020-03-29)
Gallbladder cancer is an aggressive disease with late diagnosis and no efficacious treatment. The Hippo-Yes-associated protein 1 (YAP1) signaling pathway has emerged as a target for the development of new therapeutic interventions in cancers. However, the role of the Hippo-targeted

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica