171596

β-Amyloid Peptide

≥80% (HPLC), lyophilized, 1-42, rat

• Sinônimo(s): β-Amyloid Peptide (1-42), Rat, DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
• Fórmula empírica (Notação de Hill): C₁₉₉H₃₀₇N₅₃O₅₉S
• Número CAS: 107761-42-2
• Peso molecular: 4417.95
• Número MDL: MFCD00163049
• Código UNSPSC: 12352202
• NACRES: NA.26

Propriedades

• product name: β-Amyloid Peptide (1-42), Rat,
• descrição: Predominant peptide found in the brain of patients with Alzheimer′s Disease and Down′s Syndrome. Promotes down-regulation of Bcl-2 and upregulation of Bax expression in neurons.
• Nível de qualidade: 100
• Ensaio: ≥80% (HPLC)
• forma: lyophilized
• fabricante/nome comercial: Calbiochem^®
• condição de armazenamento: OK to freeze; desiccated (hygroscopic)
• solubilidade: 5% acetic acid: 1 mg/mL
• Condições de expedição: ambient
• temperatura de armazenamento: −20°C

Descrição

Descrição geral

β-Amyloid Peptide (Aβ) is the main constituent in both senile plaques and diffuse deposits in Alzheimer′s diseased brains. Under appropriate conditions, the soluble amyloid peptides aggregate into the fibrils associated with the disease state. It has proposed that Aβ peptide may increase the sensitivity of neurons to oxidative damage by downregulating expression of bcl-2, a key anti-apoptotic protein and upregulating of bax expression, a protein known to induce cell death.

Predominant peptide found in the brain of patients with Alzheimer’s Disease and Down’s Syndrome. Promotes down-regulation of Bcl-2 and upregulation of Bax expression in neurons.

Advertência

Toxicity: Standard Handling (A)

Sequência

H-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH

Outras notas

Paradis, E., et al. 1996. J. Neurosci.16, 7533.
Roher, A.E., et al. 1996. J. Biol. Chem.271, 20631.
Soto, C., and Castano, E.M. 1996. Biochem. J.314, 701.
Murrell, J., et al. 1991. Science254, 97.
Goldgaber, D., et al. 1987. Science235, 877.
Kang, J., et al. 1987. Nature 325, 733.

Informações legais

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany

Informações de segurança

• Código de classe de armazenamento: 11 - Combustible Solids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable