WH0010009M1

Monoclonal Anti-ZBTB33 antibody produced in mouse

clone 2B2, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-ZNF348, Anti-ZNFkaiso, Anti-zinc finger and BTB domain containing 33
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 2B2, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• GenBank accession no.: BC042753
• UniProt accession no.: Q86T24
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ZBTB33(10009)

Description

General description

KAISO is a transcriptional regulator that binds, via its zinc fingers, to DNA sequences containing methylated CGCG or to the consensus KAISO-binding site (KBS) TCCTGCNA (Filion et al., 2006 [PubMed 16354688]).[supplied by OMIM

Immunogen

ZBTB33 (AAH42753, 564 a.a. ~ 673 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYLSDRSSTIPAMKDDGIGYKVDTGKEPPVGTTTSTQNKPMTWEDIFIQQENDSIFKQNVTDGSTEFEFIIPESY

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Safety Information

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)