SAB2108665

Anti-GABARAPL2

affinity isolated antibody

• Synonym(s): Anti- GATE-16, Anti- GATE16, Anti- GEF-2, Anti- GEF2, Anti-ATG8
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 14 kDa
• species reactivity: horse, rat, bovine, human, dog, goat, rabbit, mouse, guinea pig
• concentration: 0.5-1 mg/mL
• technique(s): immunoblotting: suitable
• accession no.: NM_007285
• UniProt accession no.: P60520
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... GABARAPL2(11345)

Description

Immunogen

Synthetic peptide directed towards the N terminal region of human GABARAPL2

Biochem/physiol Actions

GABARAPL2 belongs to the MAP1 LC3 family. It modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. The protein first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1.

Sequence

Synthetic peptide located within the following region: KWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLV

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable