SAB2100585

Anti-DIS3 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-DIS3 mitotic control homolog (S. cerevisiae), Anti-DKFZp667L1817, Anti-FLJ10484, Anti-KIAA1008, Anti-MGC33035
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 109 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• UniProt accession no.: Q9Y2L1
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... DIS3(22894)

Description

Immunogen

Synthetic peptide directed towards the N terminal region of human DIS3

Biochem/physiol Actions

DIS3, belonging to the ribonuclease II (RNB) family, has a 3′-5′ exonuclease activity. It is a catalytic component of the exosome 3′→5′ exoribonuclease complex required for the 3′-processing of the 7S pre-RNA to the mature 5.8S rRNA and for mRNA decay. The protein is implicated in mitotic control and essential for cell division and spore germination. It may be involved in regulating protein dephosphorylation during mitosis.

Sequence

Synthetic peptide located within the following region: DIVAVELLPKSQWVAPSSVVLHDEGQNEEDVEKEEETERMLKTAVSEKML

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable