SAB1412489

ANTI-DLX5 antibody produced in mouse

clone 1B7, purified immunoglobulin, buffered aqueous solution

• Synonym(s): DLX5
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1B7, monoclonal
• form: buffered aqueous solution
• mol wt: antigen 37.84 kDa
• species reactivity: human
• technique(s): immunohistochemistry: suitable; indirect ELISA: suitable
• isotype: IgG2bκ
• NCBI accession no.: NM_005221
• UniProt accession no.: P56178
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... DLX5(1749)

Description

General description

This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein may play a role in bone development and fracture healing. Mutation in this gene, which is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7, may be associated with split-hand/split-foot malformation. (provided by RefSeq)

Immunogen

DLX5 (NP_005212, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNR*

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable