SAB1409204

Anti-APBB2 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• Synonym(s): DKFZp434E033, FE65L, FE65L1, MGC35575
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: antigen 36.19 kDa
• species reactivity: human
• technique(s): western blot: 1 μg/mL
• NCBI accession no.: DQ894740.2
• UniProt accession no.: Q92870
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... APBB2(323)

Description

General description

The protein encoded by this gene interacts with the cytoplasmic domains of amyloid beta (A4) precursor protein and amyloid beta (A4) precursor-like protein 2. This protein contains two phosphotyrosine binding (PTB) domains, which are thought to function in signal transduction. (provided by RefSeq)

Immunogen

APBB2 (ABM85666.1, 1 a.a. ~ 329 a.a) full-length human protein.

Sequence
MAEEDLAPGKSSVAVNNCIRQLSYCKNDIRDTVGIWGEGKDMYLILENDMLSLVDPMDRSVLHSQPIVSIRVWGVGRDNGRDFAYVARDKDTRILKCHVFRCDTPAKAIATSLHEICSKIMAERKNAKALACSSLQERANVNLDVPLQDFPTPKTELVQKFHVQYLGMLPVDKPVGMDILNSAIENLMTSSNKEDWLSVNMNVADATVTVISEKNEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAGNVSEAVQAACMLRYQKCLVARPPSQKVRPPPPPADSVTRRVTTNVKRGVLSLIDTLKQKRPVTEMP

Biochem/physiol Actions

The gene APBB2 (amyloid β precursor protein binding family B member 2), also referred to as FE65-like 1, encodes an adaptor protein that binds to the cytoplasmic domain of β-amyloid precursor protein (βAPP) and processes it to form β-amyloid (Aβ). Over-expression of APBB2 leads to an accumulation of Aβ in senile plaques seen in patients with Alzheimer′s disease (AD). Mutations in this gene have been associated with AD.

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable