SAB1406659

Anti-SPOP antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• Synonym(s): TEF2
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: antigen ~42.1 kDa
• species reactivity: human
• technique(s): indirect immunofluorescence: suitable; western blot: 1 μg/mL
• NCBI accession no.: NM_001007226.1
• UniProt accession no.: O43791
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SPOP(8405)

Description

General description

Speckle type BTB/POZ protein (SPOP) is encoded by the gene mapped to human chromosome 17q21.33. The encoded protein is characterized with a substrate-binding MATH (meprin and TRAF-C homology) domain at the N-terminal and a CUL3-binding BTB domain at the C-terminal end.

This gene encodes a protein that may modulate the transcriptional repression activities of death-associated protein 6 (DAXX), which interacts with histone deacetylase, core histones, and other histone-associated proteins. In mouse, the encoded protein binds to the putative leucine zipper domain of macroH2A1.2, a variant H2A histone that is enriched on inactivated X chromosomes. The BTB/POZ domain of this protein has been shown in other proteins to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes. Alternative splicing of this gene results in multiple transcript variants encoding the same protein. (provided by RefSeq)

Immunogen

SPOP (NP_001007227.1, 1 a.a. ~ 374 a.a) full-length human protein.

Sequence
MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS

Application

Tissue microarray (TMA).

Biochem/physiol Actions

Peckle type BTB/POZ protein (SPOP) activates β-catenin/ transcription factor 4 (TCF-4) complex and stimulates tumor progression in clear cell renal cell carcinoma. The encoded protein ubiquitinates various substrates in Drosophila and human, including puckered (Puc), cubitus interruptus (Ci) / glioblastoma (Gli), macroH2A, death-associated protein 6 (DAXX) and steroid receptor coactivator (SRC)-3. It acts as a potential tumor suppressor for various cancers including breast cancer. Mutation in the gene is associated with the development of human prostate cancers.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable