General description
Transcription factor binding to IGHM enhancer 3 or transcription factor E3 (TFE3) gene is mapped to human chromosome Xp11.23. TFE3 belongs to helix-loop-helix leucine zipper family of transcription factors.
Immunogen
Transcription factor binding to ighm enhancer 3 recombinant protein epitope signature tag (PrEST).
Sequence
SKDLESRQRSLEQANRSLQLRIQELELQAQIHGLPVPPTPGLLSLATTSASDSLKPEQLDIEEEGRPGAATFHVGGGPAQNAPHQQPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDILMEEEEGVVGGLSGGALSPLRAAS
Application
Anti-TFE3(Transcription factor binding to IGHM enhancer 3) antibody produced in rabbit has been used:
- in immunofluorescence
- in immunocytochemistry studies
- in immunostaining
Biochem/physiol Actions
Transcription factor binding to IGHM enhancer 3 (TFE3) interacts with other transcription factors and plays a key role in cell growth and proliferation. It promotes renal adenocarcinoma progression. TFE3 gene locus is also involved in translocations events resulting in a TFE3 fusion protein, which is a potential marker for screening their prevalence in renal cell carcinomas. It interacts and regulates expression of G-protein Gα16 and favors regulation of claudin 14.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Legal Information
Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.