Skip to Content
MilliporeSigma
All Photos(7)

Key Documents

HPA007981

Sigma-Aldrich

Anti-RPS6KA1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-90 kDa ribosomal protein S6 kinase 1 antibody produced in rabbit, Anti-MAP kinase-activated protein kinase 1a antibody produced in rabbit, Anti-MAPKAPK1A antibody produced in rabbit, Anti-RSK-1 antibody produced in rabbit, Anti-Ribosomal S6 kinase 1 antibody produced in rabbit, Anti-Ribosomal protein S6 kinase α-1 antibody produced in rabbit, Anti-S6K-α 1 antibody produced in rabbit, Anti-p90-RSK 1 antibody produced in rabbit, Anti-p90S6K antibody produced in rabbit, Anti-pp90RSK1 antibody produced in rabbit

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

rat, human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

immunogen sequence

KMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... RPS6KA1(6195)

General description

RPS6KA1 (ribosomal protein S6 kinase, 90kDa, polypeptide 1) gene encodes a serine/threonine kinase belonging to the RSK (ribosomal S6 kinase) family. The molar mass of this protein is 90kDa and contains two kinase domains. The C-terminal kinase domain functions in autophosphorylation and activation of the amino-terminal kinase domain. The N-terminal kinase domain is involved in phosphotransferase activity.

Immunogen

Ribosomal protein S6 kinase α-1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

RPS6KA1 (ribosomal protein S6 kinase, 90kDa, polypeptide 1) is also called RSK1 and is activated by mitogenic stimuli via the pathway involving the extracellular signal-regulated kinase (ERK) subfamily of mitogen-activated protein (MAP) kinases. ERK1/ERK2 is activated by MAP kinase kinase (MEK), which is in turn is activated by Raf kinase cascade initiated by GTP-bound form of Ras. The activated ERK1/ERK2 phosphorylates RSK1 and activates it. Activated RSK1 phosphorylates various substrates including transcription factor c-Fos, the cAMP response element binding protein (CREB), the transcriptional inhibitor IκB, the estrogen receptor and the kinase Myt 1, and has been implicated in cell proliferation, differentiation and survival. RSK1 also phosphorylates p27 at T198 and increases RhoA-p27 binding, resulting in inhibition of RhoA and an increase in cell motility.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71416

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

S A Richards et al.
Current biology : CB, 9(15), 810-820 (1999-09-02)
The rsk1 gene encodes the 90 kDa ribosomal S6 kinase 1 (RSK1) protein, which contains two kinase domains. RSK1, which is involved in regulating cell survival and proliferation, lies at the end of the signaling cascade mediated by the extracellular
Michelle D Larrea et al.
Proceedings of the National Academy of Sciences of the United States of America, 106(23), 9268-9273 (2009-05-28)
p90 ribosomal S6 kinase (RSK1) is an effector of both Ras/MEK/MAPK and PI3K/PDK1 pathways. We present evidence that RSK1 drives p27 phosphorylation at T198 to increase RhoA-p27 binding and cell motility. RSK1 activation and p27pT198 both increase in early G(1).
A Shimamura et al.
Current biology : CB, 10(3), 127-135 (2000-02-19)
Growth factors activate an array of cell survival signaling pathways. Mitogen-activated protein (MAP) kinases transduce signals emanating from their upstream activators MAP kinase kinases (MEKs). The MEK-MAP kinase signaling cassette is a key regulatory pathway promoting cell survival. The downstream

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service