HPA004938

Anti-PTGDS antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(s): Anti-Beta-trace protein, Anti-Cerebrin-28, Anti-Glutathione-independent PGD synthetase, Anti-Lipocalin-type prostaglandin-D synthase, Anti-PGD2 synthase, Anti-PGDS, Anti-PGDS antibody produced in rabbit, Anti-PGDS2, Anti-PTGDS, Anti-Prostaglandin-D2 synthase, Anti-Prostaglandin-H2 D-isomerase precursor
• MDL number: MFCD03455815
• UNSPSC Code: 12352203
• Human Protein Atlas Number: HPA004938
• NACRES: NA.43

Properties

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• species reactivity: human
• technique(s): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:20-1:50
• immunogen sequence: SWLREKKAALSMCKSVVAPATDGGLNLTSTFLRKNQCETRTMLLQPAGSLGSYSYRSPHWGSTYSVSVVETDYDQYALLYSQGSKGPGEDFRMATLYSRTQT
• UniProt accession no.: P41222
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... PTGDS(5730)

Description

General description

Lipocalin-type prostaglandin D2 (PGD2) synthase (PTGDS) is responsible for the synthesis of prostaglandin D2 (PGD2). PTGDS belongs to the lipocalin ligand-carrier protein family. PTGDS is also called glutathione (GSH)- independent PGDS and is a brain type PGDS, which is found in rat brain, spinal cord, epididymis, cochlea, retina and is also found in extracellular space. In humans, PTGDS gene is located on the HSA9q34 loci of chromosome.

Immunogen

Prostaglandin-H2 D-isomerase precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

PTGDS is an important enzyme in the arachidonic pathway where it converts prostaglandin H2 (PGH2) to PGD2. PTGDS also functions as a transporter, and it has been suggested that it transports ligands such as retinoic acid, gangliosides, bile pigments and amyloid β peptides. PTGDS is also responsible for the development of male reproducitve organs and the regulation of sleep, pain sensation and allergy. Mice with unilateral cryptorchidism with second phase of testicular decent are found to be homozygous or heterozygous PTGDS deficient. Expression of PTGDS is also found to vary between manic and depressive states in patients with rapid cycling bipolar disorder. It is also expressed differentially between attention deficit hyperactivity disorder (ADHD) patients and bipolar disorder patients. PTGDS is less expressed in patients with bipolar disorder than in ADHD patients.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70110

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)