AV54324
Anti-IL1B antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-IL-1, Anti-IL1-BETA, Anti-IL1F2, Anti-Interleukin 1, β
Sign Into View Organizational & Contract Pricing
All Photos(3)
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
17 kDa
species reactivity
human
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... IL1B(3553)
General description
Interleukin-1β (IL1β) is produced by activated macrophages. It is synthesized as pro-IL-1β which is changed to active form IL-1β with the help of pro-inflammatory protease caspase-1. IL-1β belongs to the IL-1 gene family. It is a proinflammatory cytokine. The gene is mapped to human chromosome 2q14.
Immunogen
Synthetic peptide directed towards the N terminal region of human IL1B
Application
Anti-IL1B antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions
Interleukins are proinflammatory cytokines produced on cell injury or trauma. There are two closely related types of interleukins produced by the cell, IL-1α and IL-1β that are produced by the activation of NF-κB transcription factor in response to bacterial infection or LPS. Both IL-1α and IL-1β exert their cellular effects by signalling through IL-1 receptor type 1. IL-1β has pleiotropic activities and is protective against infections by recruitment of neutrophils to the infection site, secretion of cytokines and chemokines and activation of adhesion molecules. IL-1β overproduction has been implicated in many auto-immune and allergic disorders such as Cryopirin-associated periodic syndromes, Muckle-Wells syndrome and skin lesions.
Sequence
Synthetic peptide located within the following region: DLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQE
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Customers Also Viewed
Manoranjan Sahoo et al.
TheScientificWorldJournal, 11, 2037-2050 (2011-11-30)
The inflammasome is an important innate immune pathway that regulates at least two host responses protective against infections: (1) secretion of the proinflammatory cytokines IL-1β and IL-18 and (2) induction of pyroptosis, a form of cell death. Inflammasomes, of which
P C M van Poppel et al.
Diabetes, obesity & metabolism, 16(12), 1269-1273 (2014-07-22)
Inflammation at the level of the β cell appears to be involved in progressive β-cell dysfunction in type 2 diabetes. We assessed the effect of blocking interleukin-1 (IL-1) by anakinra [recombinant human interleukin-1 receptor antagonist (IL-1Ra)] on β-cell function. Sixteen
Charles A Dinarello
Current opinion in pharmacology, 4(4), 378-385 (2004-07-15)
All biological agents currently used for reducing TNFalpha activity in disease are neutralization strategies; however, there are several strategies for reducing interleukin (IL)-1 activities: the IL-1 receptor antagonist (IL-1Ra), anti-IL-1beta monoclonal antibodies, the IL-1 Trap, IL-1 receptor type I antibodies
Axel Weber et al.
Science signaling, 3(105), cm1-cm1 (2010-01-21)
The interleukin-1 (IL-1) family of cytokines comprises 11 proteins (IL-1F1 to IL-1F11) encoded by 11 distinct genes in humans and mice. IL-1-type cytokines are major mediators of innate immune reactions, and blockade of the founding members IL-1alpha or IL-1beta by
Emmanuel Contassot et al.
Swiss medical weekly, 142, w13590-w13590 (2012-06-02)
Interleukin 1, one of the first cytokines discovered in the 1980s, and a potent mediator of fever, pain and inflammation, is at present experiencing a revival in biology and medicine. Whereas the mechanism of activation and secretion of interleukin 1β
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service