Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

AV53602

Sigma-Aldrich

Anti-LDHC antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-LDH3, Anti-LDHX, Anti-Lactate dehydrogenase C, Anti-MGC111073

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

36 kDa

species reactivity

rabbit, dog, horse, rat, human, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... LDHC(3948)

General description

LDHC (lactate dehydrogenase C) gene also referred to as LDH3, LDHX or MGC111073 encodes for an enzyme that belongs to the lactate dehydrogenase family.

Immunogen

Synthetic peptide directed towards the middle region of human LDHC

Application

Anti-LDHC antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Biochem/physiol Actions

LDHC is testis-specific and acts as a key enzyme for sperm motility. It facilitates the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. Additionally, it also serves as a diagnostic marker for chronic tuberculosis. 3 LDH works to prevent muscular failure and fatigue in multiple ways.

Sequence

Synthetic peptide located within the following region: IVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Tahereh Esmaeilpour et al.
Iranian journal of medical sciences, 39(1), 20-28 (2014-01-24)
Application of follicular fluid (FF) and platelet-activating factor (PAF) in artificial insemination improves sperm motility. Lactate dehydrogenase C (LDH-C) is a key enzyme for sperm motility. In this study, the effects of FF and PAF on the sperm motility index
Lin Huang et al.
Animal biotechnology, 23(2), 114-123 (2012-04-28)
The objective of the present study was to confirm the widespread existence of alternative splicing of lactate dehydrogenase c (ldhc) gene in mammals. RT-PCR was employed to amplify cDNAs of ldhc from testes of mammals including pig, dog, rabbit, cat
Fanny Odet et al.
Biology of reproduction, 79(1), 26-34 (2008-03-28)
The lactate dehydrogenase (LDH) protein family members characteristically are distributed in tissue- and cell type-specific patterns and serve as the terminal enzyme of glycolysis, catalyzing reversible oxidation reduction between pyruvate and lactate. They are present as tetramers, and one family
P R Sharma et al.
Clinical biochemistry, 40(18), 1414-1419 (2007-10-16)
The objective of this investigation was to find out if sputum-positive (AFB test) test, which is performed to assess mycobacterial infection status, is anyway correlated with any of the LDH isoforms. And if so, can it be used, either alone
Fanny Odet et al.
Biology of reproduction, 85(3), 556-564 (2011-05-14)
We demonstrated previously that disruption of the germ cell-specific lactate dehydrogenase C gene (Ldhc) led to male infertility due to defects in sperm function, including a rapid decline in sperm ATP levels, a decrease in progressive motility, and a failure

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service