Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

AV48303

Sigma-Aldrich

Anti-UGP2 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-UDP-glucose pyrophosphorylase 2, Anti-UDPG, Anti-UDPGP2, Anti-UGPP2, Anti-pHC379

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

56 kDa

species reactivity

horse, rabbit, bovine, mouse, human, dog, guinea pig, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... UGP2(7360)

General description

UDP-glucose pyrophosphorylase 2 (UGP2) is an intermediary enzyme that transports glucose from glucose-1-phosphate to MgUTP. Studies in pigs have revealed that UGP2 is highly expressed in the liver and skeletal muscle cells.
Rabbit Anti-UGP2 antibody recognizes zebrafish, canine, chicken, bovine, pig, human, mouse, and rat UGP2.

Immunogen

Synthetic peptide directed towards the N terminal region of human UGP2

Application

Rabbit Anti-UGP2 antibody is suitable for western blot applications at a concentration of 0.25μg/ml.

Biochem/physiol Actions

UGP2 is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen; in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. The eukaryotic enzyme has no significant sequence similarity to the prokaryotic enzyme.The enzyme encoded by this gene is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen; in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. The eukaryotic enzyme has no significant sequence similarity to the prokaryotic enzyme. Two transcript variants encoding different isoforms have been found for this gene.

Sequence

Synthetic peptide located within the following region: TKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDN

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

J Y Yu et al.
Genetics and molecular research : GMR, 13(1), 1358-1365 (2014-03-19)
The function of the UDP-glucose pyrophosphorylase 2 gene (UGP2) in pig is not clear. In the present study, we used RNA isolated from Large White pigs and Chinese indigenous MeiShan pigs to examine the temporal coordination of changes in gene

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service