Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

AV32048

Sigma-Aldrich

Anti-CNOT2 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-CCR4-NOT transcription complex, subunit 2

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

40 kDa

species reactivity

dog, rabbit, mouse, bovine, human, rat, horse, guinea pig

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CNOT2(4848)

General description

CNOT2 forms a part of the transcriptional regulator, the Ccr4-Not complex, and can repress promoter functions. Studies have reported that depletion of CNOT2 inhibits CCR4-NOT deadenylase and causes apoptosis in cells. Furthermore, the SMRT/NCoR-HDAC3 complex is known to be a cofactor of CNOT2-mediated transcriptional repression.
Rabbit Anti-CNOT2 antibody recognizes bovine, human, mouse, rat, canine, and chicken CNOT2.

Immunogen

Synthetic peptide directed towards the middle region of human CNOT2

Application

Rabbit Anti-CNOT2 antibody can be used for western blot applications at a concentration of 1.25μg/ml.

Biochem/physiol Actions

CNOT2 is one of the subunits of the CCR4-NOT complex,which functions as general transcription regulation complex.

Sequence

Synthetic peptide located within the following region: SYKDPTSSNDDSKSNLNTSGKTTSSTDGPKFPGDKSSTTQNNNQQKKGIQ

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Kentaro Ito et al.
Genes to cells : devoted to molecular & cellular mechanisms, 16(4), 368-379 (2011-02-09)
Eukaryotic mRNA decay is initiated by shortening of the poly (A) tail; however, neither the molecular mechanisms underlying deadenylation nor its regulation is well understood. The human CCR4-NOT complex is a major cytoplasmic deadenylase consisting of a combination of at
Carin G M Zwartjes et al.
The Journal of biological chemistry, 279(12), 10848-10854 (2004-01-07)
The evolutionary conserved Ccr4-Not complex controls mRNA metabolism at multiple levels in eukaryotic cells. Genetic analysis of not mutants in yeast identifies a negative role in transcription, which is dependent on core promoter structure. To obtain direct support for this
Sandrine Jayne et al.
The Biochemical journal, 398(3), 461-467 (2006-05-23)
In eukaryotic cells, the Ccr4-Not complex can regulate mRNA metabolism at various levels. Previously, we showed that promoter targeting of the CNOT2 subunit resulted in strong repression of RNA polymerase II transcription, which was sensitive to the HDAC (histone deacetylase)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service