MilliporeSigma
All Photos(2)

AV100797

Sigma-Aldrich

Anti-SOX9 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):
Anti-SRY (sex determining region Y)-box 9 (campomelic dysplasia, autosomal sex-reversal)
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

56 kDa

species reactivity

rabbit, human, bovine, goat, dog, guinea pig, rat, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... SOX9(6662)

Immunogen

Synthetic peptide directed towards the N terminal region of human SOX9

Application

Anti-SOX9 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5 μg/ml.

Biochem/physiol Actions

Sox9 is a transcription factor involved in a wide range of developmental processes. It is required for cartilage development, morphogenesis of face, testis differentiation and sex determination.

Sequence

Synthetic peptide located within the following region: PCPSGSGSDTENTRPQENTFPKGEPDLKKESEEDKFPVCIREAVSQVLKG

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis

Enter Lot Number to search for Certificate of Analysis (COA).

Certificate of Origin

Enter Lot Number to search for Certificate of Origin (COO).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service