SAB2105549

Anti-SLC4A5 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-MGC129662, Anti-NBC4
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• mol wt: 126 kDa
• species reactivity: rabbit, bovine, dog, mouse, rat, human, guinea pig, horse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NM_021196
• UniProt accession no.: Q9BY07
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SLC4A5(57835)

Description

Immunogen

Synthetic peptide directed towards the middle region of human SLC4A5

Biochem/physiol Actions

This gene encodes a member of the sodium bicarbonate cotransporter (NBC) family, part of the bicarbonate transporter superfamily. Sodium bicarbonate cotransporters are involved in intracellular pH regulation and electroneural or electrogenic sodium bicarb

Sequence

Synthetic peptide located within the following region: SIAHIDSLKMETETSAPGEQPQFLGVREQRVTGIIVFILTGISVFLAPIL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1