Skip to Content
MilliporeSigma
All Photos(8)

Key Documents

HPA003890

Sigma-Aldrich

Anti-ADAR antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-136 kDa double-stranded RNA-binding protein antibody produced in rabbit, Anti-DRADA antibody produced in rabbit, Anti-Double-stranded RNA-specific adenosine deaminase antibody produced in rabbit, Anti-IFI-4 protein antibody produced in rabbit, Anti-Interferon-inducible protein 4 antibody produced in rabbit, Anti-K88DSRBP antibody produced in rabbit, Anti-P136 antibody produced in rabbit

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

independent
RNAi knockdown
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

immunogen sequence

SDNQPEGMISESLDNLESMMPNKVRKIGELVRYLNTNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFVYQAKVGGRWFPAVCAHSKKQGKQEAADAALRVLIGENEKAERMGFTEVTPVTGASLRRTMLLLSRSPEA

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ADAR(103)

General description

The gene adenosine deaminase, RNA specific (ADAR)/ ADAR1, spanning ~30Kbp on genomic DNA, is mapped to human chromosome 1q21.3. The encoded protein exists in two isoforms, namely ADAR1L and ADAR1S with molecular weight of 150kDa and 110kDa, respectively. ADAR protein contains conserved catalytic deaminase domain (DM) at C-terminal and two or three dsRNA-binding domains (dsRBDs) at the N-terminal end. The protein is expressed in wide variety of tissues, including the central nervous system (CNS).

Immunogen

Double-stranded RNA-specific adenosine deaminase recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collecation of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Anti-ADAR antibody produced in rabbit has been used in western blotting and immunohistochemical staining.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper)
Western Blotting (1 paper)

Biochem/physiol Actions

Adenosine deaminase, RNA specific (ADAR)/ ADAR1 catalyzes the hydrolytic deamination of adenosine (A) to inosine (I) in double-stranded (ds) RNAs. It plays a vital role in RNA editing. Mutation in the gene is associated with the development of Dyschromatosis symmetrica hereditaria (DSH) and autoimmune disorder Aicardi-Goutières syndrome (AGS). In addition, it is also a candidate gene for seizure disorders. Elevated expression of ADAR1 has been observed in breast cancer patients.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86657

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Daphna Nachmani et al.
PLoS pathogens, 10(2), e1003963-e1003963 (2014-03-04)
The human cytomegalovirus (HCMV) is extremely prevalent in the human population. Infection by HCMV is life threatening in immune compromised individuals and in immune competent individuals it can cause severe birth defects, developmental retardation and is even associated with tumor
Shirley Oren Ben-Shoshan et al.
RNA biology, 14(5), 587-602 (2016-07-01)
Adenosine deaminase acting on RNA (ADAR) 1 binds and edits double-stranded (ds) RNA secondary structures found mainly within untranslated regions of many transcripts. In the current research, our aim was to study the role of ADAR1 in liver homeostasis. As
A duplication in 1q21. 3 in a family with early onset and childhood absence epilepsy.
Muhle H, et al.
Epilepsia, 51(12), 2453-2456 (2010)
How asbestos drives the tissue towards tumors: YAP activation, macrophage and mesothelial precursor recruitment, RNA editing, and somatic mutations.
Rehrauer H, et al.
Oncogene, 37(20), 2645-2645 (2018)
ADAR enzyme and miRNA story: a nucleotide that can make the difference.
Sara T, et al.
International Journal of Molecular Sciences, 14(11), 22796-22816 (2013)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service