Przejdź do zawartości
Merck
Wszystkie zdjęcia(2)

Key Documents

WH0117156M1

Sigma-Aldrich

Monoclonal Anti-SCGB3A2 antibody produced in mouse

clone 1B2, purified immunoglobulin, buffered aqueous solution

Synonim(y):

Anti-LU103, Anti-PNSP1, Anti-UGRP1, Anti-secretoglobin, family 3A, member 2

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(2)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

mouse

białko sprzężone

unconjugated

forma przeciwciała

purified immunoglobulin

rodzaj przeciwciała

primary antibodies

klon

1B2, monoclonal

Postać

buffered aqueous solution

reaktywność gatunkowa

human

metody

indirect ELISA: suitable
western blot: 1-5 μg/mL

izotyp

IgG2aκ

numer dostępu GenBank

BC024232

numer dostępu UniProt

Q96PL1

Warunki transportu

dry ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... SCGB3A2(117156)

Opis ogólny

In addition to regulating thyroid-specific expression of genes, thyroid transcription factor (TITF1; MIM 600635) controls the transcription of genes specifically expressed in lung, such as surfactant proteins (e.g., SFTPA1; MIM 178630) and uteroglobin (UGB; MIM 192020). Mice lacking Ttf1 die immediately after birth from respiratory failure caused by profoundly hypoplastic lungs (Kimura et al., 1996 [PubMed 8557195]). The UGRP1 gene encodes a uteroglobin-related protein and is a downstream target of TITF1.[supplied by OMIM

Immunogen

SCGB3A2 (AAH24232, 1 a.a. ~ 93 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MKLVTIFLLVTISLCSYSATAFLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLLEALSHLV

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

nwg

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Środki ochrony indywidualnej

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Geyon L Garcia et al.
The American journal of pathology, 190(3), 543-553 (2019-12-24)
Chronic obstructive pulmonary disease (COPD) and asthma remain prevalent human lung diseases. Variability in epithelial and inflammatory components that results in pathologic heterogeneity complicates the development of treatments for these diseases. Early childhood infection with parainfluenza virus or respiratory syncytial
Maria R Stupnikov et al.
eLife, 8 (2019-10-22)
Notch signaling regulates cell fate selection during development in multiple organs including the lung. Previous studies on the role of Notch in the lung focused mostly on Notch pathway core components or receptor-specific functions. It is unclear, however, how Jagged
Benjamin J van Soldt et al.
Development (Cambridge, England), 146(9) (2019-04-05)
Although the Hippo-yes-associated protein (Yap) pathway has been implicated in lung development, the specific roles for Yap and its nucleocytoplasmic shuttling in the developing airway and alveolar compartments remain elusive. Moreover, conflicting results from expression studies and differences in the

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej