WH0023057M1

Monoclonal Anti-NMNAT2 antibody produced in mouse

clone 2E4, purified immunoglobulin, buffered aqueous solution

• Synonim(y): Nmnat2 Antibody, Nmnat2 Antibody - Monoclonal Anti-NMNAT2 antibody produced in mouse, Anti-C1orf15, Anti-KIAA0479, Anti-MGC2756, Anti-PNAT2, Anti-nicotinamide nucleotide adenylyltransferase 2
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 2E4, monoclonal
• Postać: buffered aqueous solution
• reaktywność gatunkowa: human
• metody: indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotyp: IgG1κ
• numer dostępu GenBank: NM_015039
• numer dostępu UniProt: Q9BZQ4
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... NMNAT2(23057)

Opis

Opis ogólny

NMNAT2 (nicotinamide nucleotide adenylyltransferase 2) is a rate limiting enzyme that is located on human chromosome 1q25. It is expressed in the brain. Nmnat2 is located to vesicular structures.

This gene product belongs to the nicotinamide mononucleotide adenylyltransferase (NMNAT) enzyme family, members of which catalyze an essential step in NAD (NADP) biosynthetic pathway. Unlike the other human family member, which is localized to the nucleus, and is ubiquitously expressed; this enzyme is cytoplasmic, and is predominantly expressed in the brain. Two transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Immunogen

NMNAT2 (NP_055854, 208 a.a. ~ 307 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
CIPGLWNEADMEVIVGDFGIVVVPRDAADTDRIMNHSSILRKYKNNIMVVKDDINHPMSVVSSTKSRLALQHGDGHVVDYLSQPVIDYILKSQLYINASG

Zastosowanie

Monoclonal Anti-NMNAT2 antibody has been used in immunoblotting.

Działania biochem./fizjol.

NMNAT2 (nicotinamide nucleotide adenylyltransferase 2) plays a major role in cancer suppression. It may induce multiplication and prevent apoptosis in CRC (colorectal cancer) cells. NMNAT2 participates in energy metabolism. This protein helps to postpone axon degeneration.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)