WH0007976M9

Monoclonal Anti-FZD3 antibody produced in mouse

clone 2H5, purified immunoglobulin, buffered aqueous solution

• Synonim(y): Anti-Fz3, Anti-frizzled homolog 3 (Drosophila), Anti-hFz3
• Numer MDL: MFCD06798445
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 2H5, monoclonal
• Postać: buffered aqueous solution
• reaktywność gatunkowa: human
• metody: immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotyp: IgG2aκ
• numer dostępu GenBank: NM_017412
• numer dostępu UniProt: Q9NPG1
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... FZD3(7976)

Opis

Opis ogólny

Frizzled class receptor 3 (FZD3) is a receptor with seven-transmembrane domains and it is expressed in human melanocytes. The gene encoding it is localized on human chromosome 8p21.1.

Immunogen

FZD3 (NP_059108, 55 a.a. ~ 157 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QQTAALAMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAPVAV

Działania biochem./fizjol.

Frizzled class receptor 3 (FZD3) modulates the growth of longitudinal axon tracts in the central nervous system. It mediates the dynamics of axon within the enteric, sympathetic and peripheral nervous systems. FZD3 regulates planar cell polarity. Abnormal FZD3 gene methylation causes chromatin structure modifications, associated with congenital hydrocephalus. Mutation in FZD3 gene is associated with Hirschsprung disease, a birth defect lacking the intrinsic ganglion cells of the lower intestine.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)