WH0005111M2

Monoclonal Anti-PCNA antibody produced in mouse

clone 1G7, purified immunoglobulin, buffered aqueous solution

• Synonim(y): Anti-MGC8367, Anti-proliferating cell nuclear antigen
• Numer MDL: MFCD00213036
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 1G7, monoclonal
• Formularz: buffered aqueous solution
• reaktywność gatunkowa: human
• metody: immunoprecipitation (IP): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• izotyp: IgG2aκ
• numer dostępu GenBank: BC000491
• numer dostępu UniProt: P12004
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... PCNA(5111)

Opis

Opis ogólny

Proliferating cell nuclear antigen (PCNA) is a ring-shaped homotrimer protein that is located at the center of the faithful duplication of eukaryotic genomes. Since it encircles the DNA, PCNA is also known as a sliding clamp. This gene is mapped to human chromosome 20p12.3.

The protein encoded by this gene is found in the nucleus and is a cofactor of DNA polymerase delta. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. In response to DNA damage, this protein is ubiquitinated and is involved in the RAD6-dependent DNA repair pathway. Two transcript variants encoding the same protein have been found for this gene. Pseudogenes of this gene have been described on chromosome 4 and on the X chromosome. (provided by RefSeq)

Immunogen

PCNA (AAH00491, 1 a.a. ~ 261 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS

Zastosowanie

Monoclonal Anti-PCNA antibody has been used in immunocytochemistry and western blotting.

Działania biochem./fizjol.

Proliferating cell nuclear antigen (PCNA) controls the production of the leading and lagging strands, that are required for the duplication of DNA. It acts as a cell cycle regulatory protein. This protein regulates apoptosis. PCNA is also involved in non-replicative DNA synthesis events.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)