WH0003280M1

Monoclonal Anti-HES1 antibody produced in mouse

clone 4D9, purified immunoglobulin, buffered aqueous solution

• Synonim(y): Anti-FLJ20408, Anti-HES1, Anti-HHL, Anti-HRY, Anti-hairy and enhancer of split 1, (Drosophila)
• Numer MDL: MFCD03096856
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 4D9, monoclonal
• Formularz: buffered aqueous solution
• reaktywność gatunkowa: human
• metody: indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotyp: IgG2bκ
• numer dostępu GenBank: NM_005524
• numer dostępu UniProt: Q14469
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... HES1(3280)

Opis

Opis ogólny

Hairy and enhancer of split-1 (HES1) is a transcriptional repressor. It is a member of the basic helix-loop-helix family of transcription factors. This gene is mapped to human chromosome 3q29.

This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box. (provided by RefSeq)

Immunogen

HES1 (NP_005515, 36 a.a. ~ 142 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGH

Zastosowanie

Monoclonal Anti-HES1 antibody has been used in western blotting.

Działania biochem./fizjol.

Hairy and enhancer of split-1 (HES1) is required for regulating NPC (neural progenitor cells) fate and fetal brain development. This gene also helps to maintain the undifferentiated and proliferative status of NPCs. Absence of HES1 is linked with poor prognosis in colorectal adenocarcinoma.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)