SAB5201356

Monoclonal Anti-Ataxin 1 antibody produced in mouse

clone S76-8, purified immunoglobulin

• Synonim(y): Anti-ATX1, Anti-D6S504E, Anti-Spinocerebellar ataxia type 1 protein
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: S76-8, monoclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: antigen predicted mol wt 85 kDa
• reaktywność gatunkowa: human, mouse, rat
• stężenie: 1 mg/mL
• metody: immunohistochemistry: suitable; immunoprecipitation (IP): suitable; western blot: suitable
• izotyp: IgG2b
• numer dostępu NCBI: NP_001186233.1
• numer dostępu UniProt: P54253
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: mouse ... Atxn1(20238)

Opis

Immunogen

Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).

Cechy i korzyści

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Postać fizyczna

PBS pH 7.4, 50% glycerol, 0.1% sodium azide

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable