SAB2109161

Anti-MC2R (N-terminal) antibody produced in rabbit

affinity isolated antibody

• Synonim(y): ACTHR, MGC125798
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 33 kDa
• reaktywność gatunkowa (przewidywana na podstawie homologii): bovine, mouse, rat, rabbit, guinea pig, horse, human, canine
• stężenie: 0.5 mg/mL
• metody: western blot: 1 μg/mL
• numer dostępu NCBI: NM_000529
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... MC2R(57396)

Opis

Opis ogólny

MC2R encodes one member of the five-member G-protein associated melanocortin receptor family. Melanocortins (melanocyte-stimulating hormones and adrenocorticotropic hormone) are peptides derived from pro-opiomelanocortin (POMC). MC2R is selectively activated by adrenocorticotropic hormone, whereas the other four melanocortin receptors recognize a variety of melanocortin ligands. Mutations in MC2R can result in familial glucocorticoid deficiency.

Sekwencja

Synthetic peptide located within the following region: LRNMGYLKPRGSFETTADDIIDSLFVLSLLGSIFSLSVIAADRYITIFHA

Postać fizyczna

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 12 - Non Combustible Liquids
• Klasa zagrożenia wodnego (WGK): nwg
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable