SAB2109033

Anti-BDNF (N-terminal) antibody produced in rabbit

affinity isolated antibody

• Kod UNSPSC: 12352203
• NACRES: NA.43

Właściwości

• pochodzenie biologiczne: rabbit
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 36 kDa
• reaktywność gatunkowa (przewidywana na podstawie homologii): human, rabbit, zebrafish, mouse, pig, canine, rat
• stężenie: 0.5 mg/mL
• metody: western blot: 1 μg/mL
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... BDNF(57396)

Opis

Opis ogólny

The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer′s and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene.

Immunogen

Synthetic peptide directed towards the N-terminal region of Human BDNF

Sekwencja

Synthetic peptide located within the following region: EELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYL

Postać fizyczna

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): nwg
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable