Przejdź do zawartości
Merck
Wszystkie zdjęcia(3)

Kluczowe dokumenty

SAB2108757

Sigma-Aldrich

Anti-SLC10A1

affinity isolated antibody

Synonim(y):

Anti- NTCP1, Anti-NTCP

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(3)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Formularz

buffered aqueous solution

masa cząsteczkowa

38 kDa

reaktywność gatunkowa

mouse, human, guinea pig, dog, rat

stężenie

0.5-1 mg/mL

metody

immunoblotting: suitable

nr dostępu

NM_003049

numer dostępu UniProt

Q14973

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... SLC10A1(6554)

Opis ogólny

The gene SLC10A1 (solute carrier family 10 member 1) is mapped to human chromosome 14q24.2. It is mainly expressed in the liver cells.

Immunogen

Synthetic peptide directed towards the middle region of human SLC10A1

Działania biochem./fizjol.

SLC10A1 (solute carrier family 10 member 1) is a bile acid transporter. It plays an important role in the circulation of bile acids. Mutation in this gene is associated with hypercholanemia. SLC10A1 also plays an important role in the entry of HBV (Hepatitis B virus) and silencing of this gene inhibits HBV infection. It works as a receptor for preS1 domain in HBV.

Sekwencja

Synthetic peptide located within the following region: VFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPY

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Wybierz jedną z najnowszych wersji:

Certyfikaty analizy (CoA)

Lot/Batch Number
QC49001

Nie widzisz odpowiedniej wersji?

Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.

Wyszukaj dokument COA

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Clinical and molecular study of a pediatric patient with sodium taurocholate cotransporting polypeptide deficiency.
Deng M, et al.
Experimental and Therapeutic Medicine, 12, 3294-3300 (2016)
Hepatitis B virus efficiently infects non-adherent hepatoma cells via human sodium taurocholate cotransporting polypeptide.
Okuyama-Dobashi K, et al.
Scientific Reports, 5, 17047-17047 (2015)
A genetic variant of the NTCP gene is associated with HBV infection status in a Chinese population.
Yang J, et al.
BMC Cancer, 16, 211-211 (2016)
The nuclear receptor FXR, but not LXR, up-regulates bile acid transporter expression in non-alcoholic fatty liver disease.
Aguilar-Olivos NE, et al.
Annals of Hepatology, 14, 487-493 (2015)
Fatemeh Alaei Faradonbeh et al.
Frontiers in physiology, 13, 859294-859294 (2022-04-08)
Multidrug resistance-associated protein 2 (Mrp2) mediates biliary secretion of anionic endobiotics and xenobiotics. Genetic alteration of Mrp2 leads to conjugated hyperbilirubinemia and predisposes to the development of intrahepatic cholestasis of pregnancy (ICP), characterized by increased plasma bile acids (BAs) due
Wyświetl wszystkie powiązane dokumenty

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej