SAB2108665

Anti-GABARAPL2

affinity isolated antibody

• Synonim(y): Anti- GATE-16, Anti- GATE16, Anti- GEF-2, Anti- GEF2, Anti-ATG8
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Formularz: buffered aqueous solution
• masa cząsteczkowa: 14 kDa
• reaktywność gatunkowa: horse, rat, bovine, human, dog, goat, rabbit, mouse, guinea pig
• stężenie: 0.5-1 mg/mL
• metody: immunoblotting: suitable
• nr dostępu: NM_007285
• numer dostępu UniProt: P60520
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... GABARAPL2(11345)

Opis

Immunogen

Synthetic peptide directed towards the N terminal region of human GABARAPL2

Działania biochem./fizjol.

GABARAPL2 belongs to the MAP1 LC3 family. It modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. The protein first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1.

Sekwencja

Synthetic peptide located within the following region: KWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLV

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable