Przejdź do zawartości
Merck
Wszystkie zdjęcia(1)

Kluczowe dokumenty

SAB2104747

Sigma-Aldrich

Anti-METTL3 antibody produced in rabbit

affinity isolated antibody

Synonim(y):

Anti-M6A, Anti-MGC4336, Anti-MT-A70, Anti-Spo8

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wszystkie zdjęcia(1)

About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

100

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

Formularz

buffered aqueous solution

masa cząsteczkowa

64 kDa

reaktywność gatunkowa

human, mouse, rabbit, horse, rat, guinea pig, dog, bovine

stężenie

0.5 mg - 1 mg/mL

metody

western blot: suitable

numer dostępu NCBI

NM_019852

numer dostępu UniProt

Q86U44

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... METTL3(56339)

Opis ogólny

Methyltransferase like 3 (METTL3), an RNA methyltransferase, is a member of the class I methyltransferase (MTase) family and contains the MTase domain. The METTL3 gene is mapped to human chromosome 14q11.2.

Immunogen

Synthetic peptide directed towards the middle region of human METTL3

Zastosowanie

Anti-METTL3 antibody produced in rabbit has been used in western blotting.

Działania biochem./fizjol.

Methyltransferase like 3 (METTL3) is part of methyltransferase systems that mediates the m6methyladenosine modifications. It exists as a heterodimeric complex with METTL14. An elevated expression of METTL3 is observed in clear cell renal cell carcinoma and rheumatoid arthritis (RA). Mutations in the METTL3 gene are implicated in autoimmune thyroid disease (AITD) and neuroblastoma. It may function as a tumor-suppresser in colorectal cancer.

Sekwencja

Synthetic peptide located within the following region: IVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNVQPNWITLGNQLD

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 3

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Wybierz jedną z najnowszych wersji:

Certyfikaty analizy (CoA)

Lot/Batch Number
QC9163

Nie widzisz odpowiedniej wersji?

Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.

Wyszukaj dokument COA

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Xiang Wang et al.
Nature, 534(7608), 575-578 (2016-06-10)
Chemical modifications of RNA have essential roles in a vast range of cellular processes. N(6)-methyladenosine (m(6)A) is an abundant internal modification in messenger RNA and long non-coding RNA that can be dynamically added and removed by RNA methyltransferases (MTases) and
Jun Bian et al.
Journal of cellular and molecular medicine, 24(16), 9280-9286 (2020-07-03)
Neuroblastoma ranks as the most commonly seen and deadly solid tumour in infancy. The aberrant activity of m6 A-RNA methyltransferase METTL3 is involved in human cancers. Therefore, functional genetic variants in the METTL3 gene may contribute to neuroblastoma risk. In
Wenhui Zheng et al.
Frontiers in oncology, 9, 1403-1403 (2020-01-11)
Methyltransferase-like 3 (METTL3), a predominantly catalytic enzyme in the N6-methyladenosine (m6A) methyltransferase system, is dysregulated and plays a dual role (oncogene or tumor suppressor) in different human cancers. The expression and pro- or anticancer role of METTL3 in different cancers
Fang Yu et al.
Nucleic acids research, 49(10), 5779-5797 (2021-05-29)
Faithful genome integrity maintenance plays an essential role in cell survival. Here, we identify the RNA demethylase ALKBH5 as a key regulator that protects cells from DNA damage and apoptosis during reactive oxygen species (ROS)-induced stress. We find that ROS

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej