SAB2100064

Anti-ADRB1 antibody produced in rabbit

affinity isolated antibody

• Synonim(y): Anti-β1AR, Anti-ADRB1R, Anti-Adrenergic, β-1-, receptor, Anti-B1AR, Anti-RHR
• Numer MDL: MFCD01321640
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• masa cząsteczkowa: 51 kDa
• reaktywność gatunkowa: pig, rat, mouse, human
• opakowanie: pkg of 100 μL buffered aqueous solution; pkg of 50 μg lyophilized powder
• stężenie: 0.5 mg - 1 mg/mL
• metody: western blot: suitable
• numer dostępu UniProt: P08588
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... ADRB1(153)

Opis

Immunogen

Synthetic peptide directed towards the middle region of human ADRB1

Działania biochem./fizjol.

The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in ADRB1 gene have been shown to affect the resting heart rate and can be involved in heart failure.The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in this gene have been shown to affect the resting heart rate and can be involved in heart failure. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Sekwencja

Synthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable