SAB1408035

Anti-APOL3 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• Synonim(y): APOLIII, CG12-1
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: antigen ~36.5 kDa
• reaktywność gatunkowa: human
• metody: western blot: 1 μg/mL
• numer dostępu NCBI: NM_014349
• numer dostępu UniProt: O95236
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... APOL3(80833)

Opis

Opis ogólny

This gene is a member of the apolipoprotein L gene family, and it is present in a cluster with other family members on chromosome 6. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids, including cholesterol, and/or allow the binding of lipids to organelles. In addition, expression of this gene is up-regulated by tumor necrosis factor-alpha in endothelial cells lining the normal and atherosclerotic iliac artery and aorta. Alternative splicing results in multiple transcript variants. (provided by RefSeq)

Immunogen

APOL3 (NP_055164.1, 1 a.a. ~ 331 a.a) full-length human protein.

Sequence
MDSEKKRFTEEATKYFRERVSPVHLQILLTNNEAWKRFVTAAELPRDEADALYEALKKLRTYAAIEDEYVQQKDEQFREWFLKEFPQVKRKIQESIEKLRALANGIEEVHRGCTISNVVSSSTGAASGIMSLAGLVLAPFTAGTSLALTAAGVGLGAASAVTGITTSIVEHSYTSSAEAEASRLTATSIDRLKVFKEVMRDITPNLLSLLNNYYEATQTIGSEIRAIRQARARARLPVTTWRISAGSGGQAERTIAGTTRAVSRGARILSATTSGIFLALDVVNLVYESKHLHEGAKSASAEELRRQAQELEENLMELTQIYQRLNPCHTH

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable