SAB1406448

Anti-SLC11A1 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• Synonim(y): LSH, NRAMP, NRAMP1
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: antigen ~19.2 kDa
• reaktywność gatunkowa: human
• metody: western blot: 1 μg/mL
• numer dostępu NCBI: BC041787.1
• numer dostępu UniProt: P49279
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... SLC11A1(6556)

Opis

Opis ogólny

This gene is a member of the solute carrier family 11 (proton-coupled divalent metal ion transporters) family and encodes a multi-pass membrane protein. The protein functions as a divalent transition metal (iron and manganese) transporter involved in iron metabolism and host resistance to certain pathogens. Mutations in this gene have been associated with susceptibility to infectious diseases such as tuberculosis and leprosy, and inflammatory diseases such as rheumatoid arthritis and Crohn disease. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined. (provided by RefSeq)

Immunogen

SLC11A1 (AAH41787.1, 1 a.a. ~ 178 a.a) full-length human protein.

Sequence
MTGDKGPQRLSGSSYGSISSPTSPTSPGPQQAPPRETYLRNIESDLQAGAVAGFKLLWVLLWATVLGLLCQRLAARLGVVTGKDLGEVCHLYYPKVPRTVLWLTIELAIVGSDMQEVIGTAIAFNLLSAGRYHPSVPQLFRPGREQLLLLPPLTSPSQSLFYPAVPSEAGLLPCFPEM

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable