SAB1406282

Anti-PPP1CB antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• Synonim(y): MGC3672, PP-1B, PPP1CD
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Formularz: buffered aqueous solution
• masa cząsteczkowa: antigen ~37.2 kDa
• reaktywność gatunkowa: human
• metody: western blot: 1 μg/mL
• numer dostępu NCBI: NM_002709.2
• numer dostępu UniProt: P62140
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... PPP1CB(5500)

Opis

Opis ogólny

Protein phosphatase 1 catalytic subunit β (PPP1CB), is encoded by the gene mapped to human chromosome 2p23.2. The protein is expressed in spines, dendrites, axon terminals, axons, and glia in the prefrontal cortex, but at higher levels in dendrites. PPP1CB is characterized with a calcineurin-like phosphoesterase domain, a metallophosphatase domain and a serine/threonine protein phosphatase domain.

The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Mouse studies suggest that PP1 functions as a suppressor of learning and memory. Two alternatively spliced transcript variants encoding distinct isoforms have been observed. (provided by RefSeq)

Immunogen

PPP1CB (NP_002700.1, 1 a.a. ~ 327 a.a) full-length human protein.

Sequence
MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR

Działania biochem./fizjol.

Protein phosphatase 1 catalytic subunit β (PPP1CB) plays a vital role in various cellular processes, such as cell adhesion, cell cycle, small GTPase-mediated signal transduction, protein dephosphorylation, negative regulation of transforming growth factor, regulation of glycogen catabolic process and striated muscle tissue development. In brain, PPP1CB regulates synaptic plasticity. Mutation in the gene causes intellectual disability (ID), congenital heart disease. In addition, variation in the gene expression is also associated with the development of features resembling noonan syndrome with loose anagen hair (NS-LAH).

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable