SAB1402110

Monoclonal Anti-NR0B1, (C-terminal) antibody produced in mouse

clone 1F10, purified immunoglobulin, buffered aqueous solution

• Synonim(y): AHC, AHCH, AHX, DAX-1, DAX1, DSS, GTD, HHG, NROB1
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 1F10, monoclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: antigen ~38.21 kDa
• reaktywność gatunkowa: human
• metody: capture ELISA: suitable; direct immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotyp: IgG3κ
• numer dostępu NCBI: NM_000475
• numer dostępu UniProt: P51843
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... NR0B1(190)

Opis

Opis ogólny

This gene encodes a protein that contains a DNA-binding domain. The encoded protein acts as a dominant-negative regulator of transcription which is mediated by the retinoic acid receptor. This protein also functions as an anti-testis gene by acting antagonistically to Sry. Mutations in this gene result in both X-linked congenital adrenal hypoplasia and hypogonadotropic hypogonadism. (provided by RefSeq)

Immunogen

NR0B1 (NP_000466, 361 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
IKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQQILSEHTRMTHQGPHDRFIELNSTLFLLRFINANVIAELFFRPIIGTVSMDDMMLEMLCTKI

Działania biochem./fizjol.

The encoded orphan nuclear receptor is involved in the growth and activity of the adrenal and reproductive organs. It is significantly associated with the growth of gonads, development of sexual characteristics and steroidogenesis. The expression of NR0B1 (nuclear receptor subfamily 0 group B member 1) gene is regulated by Nanog (transcription factor). NR0B1 is known to control pluripotency and differentiation of embryonic stem cells in mice. Mutation in NR0B1 is importantly associated with X-linked adrenal hypoplasia congenita. Mutations in NR0B1 is also known to downregulate the androgen receptor activity, also leading to defect in spermatogenesis.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable