SAB1401383
Anti-TFAM antibody produced in rabbit
purified immunoglobulin, buffered aqueous solution
Synonim(y):
MtTF1, TCF6, TCF6L1, TCF6L2, TCF6L3, mtTFA
Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
About This Item
Kod UNSPSC:
12352203
NACRES:
NA.41
Polecane produkty
pochodzenie biologiczne
rabbit
Poziom jakości
białko sprzężone
unconjugated
forma przeciwciała
purified immunoglobulin
rodzaj przeciwciała
primary antibodies
klon
polyclonal
Postać
buffered aqueous solution
reaktywność gatunkowa
mouse, human
metody
western blot: 1 μg/mL
numer dostępu NCBI
numer dostępu UniProt
Warunki transportu
dry ice
temp. przechowywania
−20°C
docelowa modyfikacja potranslacyjna
unmodified
informacje o genach
human ... TFAM(7019)
Powiązane kategorie
Opis ogólny
Mitochondrial transcription factor A (TFAM) is a high-mobility group (HMG) protein and is made up of two HMG-box domains. The TFAM gene is located on the human chromosome at 10q21.1.
Immunogen
TFAM (NP_003192.1, 1 a.a. ~ 246 a.a) full-length human protein.
Sequence
MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC
Sequence
MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC
Zastosowanie
Anti-TFAM antibody produced in rabbit has been used in western blotting (1:1000) and immunofluorescence.
Działania biochem./fizjol.
Mitochondrial transcription factor A (TFAM) is involved in mitochondrial DNA (mtDNA) synthesis, expression, and packaging. It is also involved in regulating the aggregation of mtDNA. TFAM stabilizes the mtDNA by binding to it in a sequence-depending manner and forms a nucleoid.
Postać fizyczna
Solution in phosphate buffered saline, pH 7.4
Oświadczenie o zrzeczeniu się odpowiedzialności
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.
Nie możesz znaleźć właściwego produktu?
Wypróbuj nasz Narzędzie selektora produktów.
Kod klasy składowania
10 - Combustible liquids
Temperatura zapłonu (°F)
Not applicable
Temperatura zapłonu (°C)
Not applicable
Certyfikaty analizy (CoA)
Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
Maik Hüttemann et al.
Clinical science (London, England : 1979), 124(11), 663-674 (2012-12-21)
Alternative approaches to reduce congenital muscle dysfunction are needed in cases where the ability to exercise is limited. (-)-Epicatechin is found in cocoa and may stimulate capillarity and mitochondrial proliferation in skeletal muscle. A total of 21 male rats bred
Victoria Alvarez et al.
Journal of Alzheimer's disease : JAD, 13(3), 275-280 (2008-04-24)
Impaired mitochondrial function and an increased number of mutations in mitochondrial DNA (mtDNA) has been found in brains of patients with late-onset Alzheimer's disease (LOAD). The TFAM-gene encodes the mitochondrial transcription factor A, a protein that controls the transcription, replication
Ryan Neil Marshall et al.
Frontiers in physiology, 13, 1097988-1097988 (2023-01-24)
Background: Ageing is associated with alterations to skeletal muscle oxidative metabolism that may be influenced by physical activity status, although the mechanisms underlying these changes have not been unraveled. Similarly, the effect of resistance exercise training (RET) on skeletal muscle
Leonardo Nogueira et al.
The Journal of physiology, 589(Pt 18), 4615-4631 (2011-07-27)
The flavanol (-)-epicatechin, a component of cacao (cocoa), has been shown to have multiple health benefits in humans. Using 1-year-old male mice, we examined the effects of 15 days of (-)-epicatechin treatment and regular exercise on: (1) exercise performance, (2)
Yoshiyuki Ikeda et al.
Circulation research, 116(2), 264-278 (2014-10-22)
Both fusion and fission contribute to mitochondrial quality control. How unopposed fusion affects survival of cardiomyocytes and left ventricular function in the heart is poorly understood. We investigated the role of dynamin-related protein 1 (Drp1), a GTPase that mediates mitochondrial
Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.
Skontaktuj się z zespołem ds. pomocy technicznej