Wszystkie zdjęcia(8)
Key Documents
HPA021367
Anti-IGF2BP1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonim(y):
Anti-CRD-BP, Anti-Coding region determinant-binding protein, Anti-IGF-II mRNA-binding protein 1, Anti-IGF2 mRNA-binding protein 1, Anti-IMP-1, Anti-Insulin-like growth factor 2 mRNA-binding protein 1, Anti-VICKZ family member 1, Anti-ZBP-1, Anti-Zip code-binding protein 1
Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
About This Item
Polecane produkty
pochodzenie biologiczne
rabbit
białko sprzężone
unconjugated
forma przeciwciała
affinity isolated antibody
rodzaj przeciwciała
primary antibodies
klon
polyclonal
linia produktu
Prestige Antibodies® Powered by Atlas Antibodies
Postać
buffered aqueous glycerol solution
reaktywność gatunkowa
human
rozszerzona walidacja
independent
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
metody
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500
sekwencja immunogenna
DVAAMSLQSHLIPGLNLAAVGLFPASSSAVPPPPSSVTGAAPYSSFMQAPEQEMVQVFIPAQAVGAIIGKK
numer dostępu UniProt
Warunki transportu
wet ice
temp. przechowywania
−20°C
docelowa modyfikacja potranslacyjna
unmodified
informacje o genach
human ... IGF2BP1(10642)
Opis ogólny
The gene IGF2BP1 (insulin-like growth factor 2 mRNA-binding protein 1) is mapped to human chromosome 17q21. It belongs to the IGF (insulin-like growth factor)-II mRNA-binding proteins family. The protein contains RNA recognition motifs and K-homology domains. IGF2BP1 localizes mainly in the cytoplasm and subcytoplasmic domains. IGF2BP1 is also referred to as IMP1 (insulin-like growth factor 2 mRNA-binding protein 1) or CRD-BP (coding region determinant-binding protein).
Immunogen
Insulin-like growth factor 2 mRNA-binding protein 1 recombinant protein epitope signature tag (PrEST)
Zastosowanie
Anti-IGF2BP1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Działania biochem./fizjol.
IGF2BP1 (insulin-like growth factor 2 mRNA-binding protein 1) is important for the mRNA localization, turnover and translational control. It binds to the target mRNAs and thereby regulates its cytoplasmic fate. For instance, it binds to the 3′-untranslated region of CD44 mRNA and stabilizes it. Similarly, it interacts with the coding region of βTrCP1 (F-box and WD repeats protein) mRNA and stabilizes it. IGF2BP1 is up-regulated in non-small cell lung cancers and is associated with tumor progression. It is also up-regulated in neuroblastoma.
Cechy i korzyści
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Powiązanie
Corresponding Antigen APREST75731
Postać fizyczna
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Informacje prawne
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Oświadczenie o zrzeczeniu się odpowiedzialności
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.
Nie możesz znaleźć właściwego produktu?
Wypróbuj nasz Narzędzie selektora produktów.
Kod klasy składowania
10 - Combustible liquids
Klasa zagrożenia wodnego (WGK)
WGK 1
Temperatura zapłonu (°F)
Not applicable
Temperatura zapłonu (°C)
Not applicable
Certyfikaty analizy (CoA)
Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
Mark Barnes et al.
The Journal of biological chemistry, 290(1), 625-639 (2014-11-13)
The ability of its four heterogeneous nuclear RNP-K-homology (KH) domains to physically associate with oncogenic mRNAs is a major criterion for the function of the coding region determinant-binding protein (CRD-BP). However, the particular RNA-binding role of each of the KH
Aiting Yan et al.
Oncology letters, 20(6), 359-359 (2020-11-03)
Esophageal cancer (ESCA) is the eighth most common cause of cancer-associated mortality in humans. An increasing number of studies have demonstrated that microRNAs (miRs) serve important roles in mediating tumor initiation and progression. miR-454-3p has been found to be involved
Jacob Nielsen et al.
The Biochemical journal, 376(Pt 2), 383-391 (2003-08-19)
The human IMPs (insulin-like growth factor II mRNA-binding proteins) belong to a vertebrate zipcode-binding protein family consisting of two RNA recognition motifs and four K homology domains and have been implicated in cytoplasmic mRNA localization, turnover and translational control. In
Tatsuya Kato et al.
Clinical cancer research : an official journal of the American Association for Cancer Research, 13(2 Pt 1), 434-442 (2007-01-27)
To identify novel biomarkers and therapeutic targets for lung cancers, we screened for genes that were highly transactivated in a large proportion of non-small cell lung cancers (NSCLC) using a cDNA microarray representing 27,648 genes. A gene encoding insulin-like growth
J Nielsen et al.
Molecular and cellular biology, 19(2), 1262-1270 (1999-01-16)
Insulin-like growth factor II (IGF-II) is a major fetal growth factor. The IGF-II gene generates multiple mRNAs with different 5' untranslated regions (5' UTRs) that are translated in a differential manner during development. We have identified a human family of
Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.
Skontaktuj się z zespołem ds. pomocy technicznej