HPA014736
Anti-SLC13A3 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonim(y):
Anti-Na(+)/dicarboxylate cotransporter 3, Anti-NaDC-3, Anti-Sodium-dependent high-affinity dicarboxylate transporter 2, Anti-Solute carrier family 13 member 3, Anti-hNaDC3
Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
About This Item
Polecane produkty
pochodzenie biologiczne
rabbit
białko sprzężone
unconjugated
forma przeciwciała
affinity isolated antibody
rodzaj przeciwciała
primary antibodies
klon
polyclonal
linia produktu
Prestige Antibodies® Powered by Atlas Antibodies
Formularz
buffered aqueous glycerol solution
reaktywność gatunkowa
human
rozszerzona walidacja
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
metody
immunohistochemistry: 1:50- 1:200
sekwencja immunogenna
SLFGQKEVRKDPSQESEENTAAVRRNGLHTVPTEMQFLASTEAKDHPGETEVPLDLPADSRKEDEYRRNIWKGFL
numer dostępu UniProt
Warunki transportu
wet ice
temp. przechowywania
−20°C
docelowa modyfikacja potranslacyjna
unmodified
informacje o genach
human ... SLC13A3(64849)
Opis ogólny
SLC13A3 (solute carrier family 13, member 3) należy do rodziny SLC13 składającej się z pięciu członków. Rodzina ta dzieli się na kotransportery Na+-siarczanu(NaS) i kotransportery Na+-karboksylanu(NaC), a SLC13A3 należy do tej drugiej grupy. Jest to transporter z 12 regionami transbłonowymi i składa się z 602 aminokwasów. Gen ten mapuje się na ludzkim chromosomie 20q12-13.1, zajmuje ponad 80 kb, ma 13 eksonów i 12 intronów. Posiada trzy przewidywane miejsca glikozylacji N-linków. Jest zlokalizowany w komórkach kanalików proksymalnych w błonie podstawno-bocznej. Ulega również ekspresji w mózgu, wątrobie, trzustce i łożysku.
Immunogen
Solute carrier family 13 member 3 recombinant protein epitope signature tag (PrEST)
Zastosowanie
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Działania biochem./fizjol.
SLC13A3 (solute carrier family 13, member 3) działa we współpracy z transporterem anionów organicznych 1 (OAT1) i OAT3) w celu ułatwienia uwalniania wielu endogennych i egzogennych jonów organicznych. Dostarcza wewnątrzkomórkowy α-ketoglutaran, w sposób zależny od Na+, do OAT1 i 3, aby umożliwić wymianę anionów organicznych/dikarboksylanów. Jest to transporter glutationu (GSH) o niskim powinowactwie. Odpowiada za wychwyt GSH przez komórki kanalików proksymalnych błony podstawno-bocznej w sposób zależny od sodu. Mutacje w tym genie mogą mieć związek z idiopatyczną kamicą nerkową. Transporter ten jest również odpowiedzialny za wychwyt N-karbamoiloglutaminianu (NCG) z krwi. NCG jest lekiem stosowanym w leczeniu wrodzonego niedoboru syntazy n-acetyloglutaminianu. SLC13A3 może być zaangażowany w mielinizację, ponieważ jest odpowiedzialny za zależny od Na+ transport N-acetyloasparaginianu w mózgu.
Cechy i korzyści
4357 to wysoce scharakteryzowane i wszechstronnie zwalidowane przeciwciała z dodatkową korzyścią w postaci wszystkich dostępnych danych dotyczących charakterystyki każdego celu, które są dostępne za pośrednictwem portalu Human Protein Atlas, do którego link znajduje się tuż pod nazwą produktu na górze tej strony. Wyjątkowość i niska reaktywność krzyżowa przeciwciał 4357 z innymi białkami wynika z dokładnego doboru regionów antygenowych, oczyszczania metodą powinowactwa i rygorystycznej selekcji. Kontrole antygenów Prestige są dostępne dla każdego odpowiedniego przeciwciała Prestige i można je znaleźć w sekcji powiązań.
Każde przeciwciało Prestige jest testowane w następujący sposób:
Każde przeciwciało Prestige jest testowane w następujący sposób:
- Macierz tkankowa IHC 44 normalnych tkanek ludzkich i 20 najczęściej występujących tkanek nowotworowych.
- Macierz białkowa 364 ludzkich rekombinowanych fragmentów białkowych.
Powiązanie
Odpowiadający antygen APREST73142
Postać fizyczna
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Informacje prawne
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Ta strona może zawierać tekst przetłumaczony maszynowo.
Nie możesz znaleźć właściwego produktu?
Wypróbuj nasz Narzędzie selektora produktów.
Kod klasy składowania
10 - Combustible liquids
Klasa zagrożenia wodnego (WGK)
WGK 1
Temperatura zapłonu (°F)
Not applicable
Temperatura zapłonu (°C)
Not applicable
Środki ochrony indywidualnej
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Wybierz jedną z najnowszych wersji:
Certyfikaty analizy (CoA)
Lot/Batch Number
Nie widzisz odpowiedniej wersji?
Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
Lena Schorbach et al.
Nephron. Physiology, 124(1-2), 1-5 (2013-11-20)
During a single pass through the kidneys, more than 80% of glutathione (GSH) is excreted, indicating not only glomerular filtration, but also tubular secretion. The first step in tubular secretion is the uptake of a substance across the basolateral membrane
H Wang et al.
American journal of physiology. Cell physiology, 278(5), C1019-C1030 (2000-05-04)
We have cloned and functionally characterized the human Na(+)-dependent high-affinity dicarboxylate transporter (hNaDC3) from placenta. The hNaDC3 cDNA codes for a protein of 602 amino acids with 12 transmembrane domains. When expressed in mammalian cells, the cloned transporter mediates the
Elisabeth Schwob et al.
American journal of physiology. Renal physiology, 307(12), F1373-F1379 (2014-10-31)
Inborn defects in N-acetylglutamate (NAG) synthase (NAGS) cause a reduction of NAG, an essential cofactor for the initiation of the urea cycle. As a consequence, blood ammonium concentrations are elevated, leading to severe neurological disorders. The orphan drug N-carbamoylglutamate (NCG;
W Huang et al.
The Journal of pharmacology and experimental therapeutics, 295(1), 392-403 (2000-09-19)
N-Acetylaspartate is a highly specific marker for neurons and is present at high concentrations in the central nervous system. It is not present at detectable levels anywhere else in the body other than brain. Glial cells express a high-affinity transporter
Daniel Markovich et al.
Pflugers Archiv : European journal of physiology, 447(5), 594-602 (2003-08-14)
The SLC13 gene family consist of five sequence-related members that have been identified in a variety of animals, plants, yeast and bacteria. Proteins encoded by these genes are divided into two functionally unrelated groups: the Na(+)-sulphate (NaS) cotransporters and the
Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.
Skontaktuj się z zespołem ds. pomocy technicznej