HPA011332

Anti-IGF2R antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonim(y): Anti-300 kDa mannose 6-phosphate, Anti-CI Man-6-P receptor, Anti-CI-MPR, Anti-Cation-independent mannose-6-phosphate receptor precursor, Anti-IGF-II receptor, Anti-Insulin-like growth factor 2 receptor, Anti-Insulin-like growth factor II receptor, Anti-M6P/IGF2 receptor, Anti-M6P/IGF2R, Anti-M6PR
• Kod UNSPSC: 12352203
• Numer w atlasie ludzkich białek: HPA011332
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• linia produktu: Prestige Antibodies^® Powered by Atlas Antibodies
• Postać: buffered aqueous glycerol solution
• reaktywność gatunkowa: human
• metody: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• sekwencja immunogenna: CKKDIFKANKEVPCYVFDEELRKHDLNPLIKLSGAYLVDDSDPDTSLFINVCRDIDTLRDPGSQLRACPPGTAACLVRGHQAFDVGQPRDGLKLVRKDRLVLSYVREEAGKLDFCDGHSPAVTITFVCPSE
• numer dostępu UniProt: P11717
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... IGF2R(3482)

Opis

Opis ogólny

IGF2R (insulin-like growth factor 2 receptor) is a transmembrane glycoprotein. It is one of the two mannose 6-phosphate (M6P) receptors found in mammalian cells. It has 15 consecutive repeating regions making up a repetitive structure. The domains 3 and 9 contain M6P-binding sites. Domain 5 contains M6P-N-acetylglucosamine residue- binding site. The IGF-II binding site is located in domain 11. It belongs to p-lectin family and has a molecular weight of 300kDa. It has an N-terminal, a small cytosolic C-terminal, a transmembrane region and a large exosolic domain.

Immunogen

Cation-independent mannose-6-phosphate receptor precursor recombinant protein epitope signature tag (PrEST)

Zastosowanie

Anti-IGF2R antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Działania biochem./fizjol.

IGF2R (insulin-like growth factor 2 receptor) regulates multiple cellular processes such as, cell survival, proliferation, migration and invasion, endocytosis, lysosomal trafficking. Its ligands are divided in two major classes- mannose 6-phosphate (M6P)-containing and non-M6P. The former class includes lysosomal acid hydrolases, TGF (transforming growth factor)-β, proliferin, thyroglobulin, and granzyme B, while the latter class includes mitogen, plasminogen, insulin-like growth factor II (IGF-II) and retinoic acid. Binding of plasminogen to IGF2R leads to the conversion and activation of plasminogen to plasmin. This gene is also mutated in multiple cancers where it might lead to tumorigenesis. It is down-regulated in breast cancer where it supposedly facilitates tumorigenesis. It decreases the metastatic capacity of receptor-deficient SCC-VII squamous cell carcinoma cells, which in turn is modulated by M6P-binding site within domain 3.

Cechy i korzyści

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST86865

Postać fizyczna

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)